Alle primære antistoffer
Primære antistoffer, immunoglobuliner, der binder til specifikke proteiner eller andre biomolekyler, bruges i mange forskningsapplikationer og protokoller til at påvise mål af interesse. De er udviklet ved hjælp af forskellige dyreværter, herunder mus, rotte, kanin, ged, får og mange andre.
Monoklonale
og polyklonale antistoffer En type primære antistoffer, monoklonale antistoffer, giver høj reproducerbarhed og lav krydsreaktivitet og baggrundsstøj. En anden type, polyklonale antistoffer, koster ofte mindre og giver større affinitet og hurtigere binding. Begge er produceret ved hjælp af plasma B-celler, men førstnævnte bruger den samme klon, og sidstnævnte bruger forskellige kloner. Monoklonale antistoffer kræver hybridomcellelinjer, og polyklonale antistoffer gør det ikke.
Der er også rekombinante monoklonale antistoffer med lignende fordele, såsom høj affinitet, skalerbarhed og specificitet. De er produceret vha in vitro kloning af plasma B-celler og ekspressionsværter.
Konjugerede primære
antistoffer Antistoffer kan mærkes med forskellige fluoroforer eller detektionsmidler eller anvendes uden mærker. Mærkede primære antistoffer, også kendt som konjugerede primære antistoffer, hjælper forskere med at forenkle og strømline deres applikationer. De er koblet med almindelige enzymer og farvestoffer såsom Alexa Fluor og bruges ofte i protein- og celleanalyse.
Anvendelser Antistoffer til biovidenskabsapplikationer bruges i flowcytometri, western blotting, ELISA, immunhistokemi og immuncytokemi. Sekundære antistoffer kan tilsættes for at understøtte påvisning og oprensning af visse antigener. De binder til det primære antistof, som binder til antigenet af interesse. At finde den rigtige kombination af antistoffer kan resultere i større antigenspecificitet og et stærkt, detekterbart signal.
- (3)
- (8)
- (10)
- (2)
- (31)
- (54)
- (1)
- (4)
- (4)
- (1)
- (113)
- (263)
- (167)
- (1,578)
- (5)
- (66)
- (1)
- (1,525)
- (1)
- (56)
- (1)
- (1)
- (2)
- (92)
- (4)
- (3)
- (5)
- (1)
- (6,075)
- (787)
- (5,505)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (5)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (6,261)
- (1)
- (1)
- (1)
- (2)
- (17)
- (3)
- (2)
- (751)
- (5,514)
- (5)
- (9)
- (8)
- (5)
- (1)
- (5)
- (102)
- (24)
- (1)
- (7)
- (31)
- (1)
- (6,092)
- (3)
- (2)
- (1)
- (1)
- (1)
Filtrerede søgeresultater
Invitrogen™ La Crosse Virus Monoclonal Antibody (8C2.2)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ La Crosse Virus Monoclonal Antibody (10G5.4)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
| Værtsarter | Rabbit |
|---|---|
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Primær eller sekundær | Primary |
| Klassifikation | Polyclonal |
| Antigen | CNTNAP3 |
| Gene Alias | contactin associated protein-like 3 |
| Gensymboler | CNTNAP3 |
| Applikationer | Western Blot |
| Immunogen | Synthetic peptides corresponding to CNTNAP3(contactin associated protein-like 3) The peptide sequence was selected from the middle region of CNTNAP3. Peptide sequence GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA. |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 79937 |
| Molekylvægt af antigen | 141 kDa |
| Primær eller sekundær | Primary |
|---|---|
| Klassifikation | Polyclonal |
| Antigen | TMEM206 |
| Gene Alias | transmembrane protein 206 |
| Gensymboler | TMEM206 |
| Værtsarter | Rabbit |
| Applikationer | Western Blot |
| Konjugeret | Unconjugated |
| Immunogen | Synthetic peptides corresponding to C1ORF75 The peptide sequence was selected from the N terminal of C1ORF75. Peptide sequence IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP. |
| Isotype | IgG |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 55248 |
| Værtsarter | Rabbit |
|---|---|
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Primær eller sekundær | Primary |
| Genadgangsnr. | Q29983 |
| Klassifikation | Polyclonal |
| Antigen | MICA |
| Gene Alias | FLJ60820, MGC111087, PERB11.1 |
| Gensymboler | MICA |
| Applikationer | Western Blot |
| Immunogen | Synthetic peptides corresponding to MICA(MHC class I polypeptide-related sequence A) The peptide sequence was selected from the N terminal of MICA. Peptide sequence LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ. |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 100507436 |
| Værtsarter | Rabbit |
|---|---|
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Primær eller sekundær | Primary |
| Genadgangsnr. | Q8N9X5 |
| Klassifikation | Polyclonal |
| Antigen | TMEM75 |
| Gene Alias | FLJ36105, transmembrane protein 75 |
| Gensymboler | TMEM75 |
| Applikationer | Western Blot |
| Immunogen | Synthetic peptides corresponding to TMEM75(transmembrane protein 75) The peptide sequence was selected from the C terminal of TMEM75. Peptide sequence VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS. |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 641384 |
| Molekylvægt af antigen | 15 kDa |
| Værtsarter | Rabbit |
|---|---|
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Primær eller sekundær | Primary |
| Klassifikation | Polyclonal |
| Antigen | C1orf174 |
| Gene Alias | chromosome 1 open reading frame 174, RP13-531C17.2 |
| Gensymboler | C1ORF174 |
| Applikationer | Western Blot |
| Immunogen | Synthetic peptides corresponding to C1ORF174 The peptide sequence was selected from the middle region of C1ORF174. Peptide sequence EAGVSVQQGAASLPLGGCRVVSDSRLAKTRDGLSVPKHSAGSGAEESNSS. |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 339448 |
| Molekylvægt af antigen | 26 kDa |
| Værtsarter | Rabbit |
|---|---|
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Primær eller sekundær | Primary |
| Klassifikation | Polyclonal |
| Antigen | CES7 |
| Gene Alias | carboxylesterase 5A, carboxylesterase 7, CAUXIN, FLJ31547 |
| Gensymboler | CES5A |
| Applikationer | Western Blot |
| Immunogen | Synthetic peptides corresponding to CES7(carboxylesterase 7) The peptide sequence was selected from the N terminal of CES7. Peptide sequence SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP. |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 221223 |
| Molekylvægt af antigen | 58 kDa |