missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
TMEM75 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59685
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
TMEM75 Polyclonal specifically detects TMEM75 in Human samples. It is validated for Western Blot.
Tekniske data
| TMEM75 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| FLJ36105, transmembrane protein 75 | |
| Rabbit | |
| 15 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8N9X5 | |
| TMEM75 | |
| Synthetic peptides corresponding to TMEM75(transmembrane protein 75) The peptide sequence was selected from the C terminal of TMEM75. Peptide sequence VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS. | |
| Affinity purified | |
| RUO | |
| 641384 | |
| Human | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion