missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
CES7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-70498
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
CES7 Polyclonal specifically detects CES7 in Human samples. It is validated for Western Blot.
Tekniske data
| CES7 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CES5A | |
| Synthetic peptides corresponding to CES7(carboxylesterase 7) The peptide sequence was selected from the N terminal of CES7. Peptide sequence SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP. | |
| Affinity purified | |
| RUO | |
| 221223 | |
| Human | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| carboxylesterase 5A, carboxylesterase 7, CAUXIN, FLJ31547 | |
| Rabbit | |
| 58 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion