missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Nephronectin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-70658
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
Nephronectin Polyclonal specifically detects Nephronectin in Human samples. It is validated for Western Blot.
Tekniske data
| Nephronectin | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| NPNT | |
| Synthetic peptides corresponding to NPNT(nephronectin) The peptide sequence was selected from the middle region of NPNT. Peptide sequence TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE. | |
| Affinity purified | |
| RUO | |
| 255743 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| nephronectin | |
| Rabbit | |
| 62 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion