Alle primære antistoffer
Primære antistoffer, immunoglobuliner, der binder til specifikke proteiner eller andre biomolekyler, bruges i mange forskningsapplikationer og protokoller til at påvise mål af interesse. De er udviklet ved hjælp af forskellige dyreværter, herunder mus, rotte, kanin, ged, får og mange andre.
Monoklonale
og polyklonale antistoffer En type primære antistoffer, monoklonale antistoffer, giver høj reproducerbarhed og lav krydsreaktivitet og baggrundsstøj. En anden type, polyklonale antistoffer, koster ofte mindre og giver større affinitet og hurtigere binding. Begge er produceret ved hjælp af plasma B-celler, men førstnævnte bruger den samme klon, og sidstnævnte bruger forskellige kloner. Monoklonale antistoffer kræver hybridomcellelinjer, og polyklonale antistoffer gør det ikke.
Der er også rekombinante monoklonale antistoffer med lignende fordele, såsom høj affinitet, skalerbarhed og specificitet. De er produceret vha in vitro kloning af plasma B-celler og ekspressionsværter.
Konjugerede primære
antistoffer Antistoffer kan mærkes med forskellige fluoroforer eller detektionsmidler eller anvendes uden mærker. Mærkede primære antistoffer, også kendt som konjugerede primære antistoffer, hjælper forskere med at forenkle og strømline deres applikationer. De er koblet med almindelige enzymer og farvestoffer såsom Alexa Fluor og bruges ofte i protein- og celleanalyse.
Anvendelser Antistoffer til biovidenskabsapplikationer bruges i flowcytometri, western blotting, ELISA, immunhistokemi og immuncytokemi. Sekundære antistoffer kan tilsættes for at understøtte påvisning og oprensning af visse antigener. De binder til det primære antistof, som binder til antigenet af interesse. At finde den rigtige kombination af antistoffer kan resultere i større antigenspecificitet og et stærkt, detekterbart signal.
- (23)
- (12)
- (28)
- (116)
- (16)
- (193)
- (83)
- (115)
- (9)
- (5,982)
- (15)
- (31)
- (45)
- (221)
- (23,073)
- (562)
- (559)
- (562)
- (19)
- (1)
- (26,367)
- (98)
- (1,050)
- (1,759)
- (1)
- (28)
- (886)
- (10)
- (6)
- (36)
- (411)
- (257)
- (10,770)
- (6,670)
- (14)
- (15,802)
- (34,234)
- (159)
- (3,895)
- (8)
- (34,281)
- (24)
- (33)
- (5,070)
- (26)
- (23)
- (8)
- (82)
- (4)
- (10)
- (1)
- (801)
- (1)
- (5)
- (9)
- (8)
- (13)
- (723)
- (1)
- (2)
- (112)
- (11)
- (1,108)
- (29)
- (97)
- (110)
- (225)
- (28)
- (9)
- (756)
- (49)
- (25)
- (9)
- (5)
- (48,690)
- (78)
- (59,264)
- (1)
- (24,518)
- (2,199)
- (372)
- (3)
- (20)
- (2,006)
- (2,199)
- (2,236)
- (2,161)
- (13)
- (1,986)
- (2,281)
- (2,195)
- (2,012)
- (2,730)
- (62)
- (34)
- (97)
- (7)
- (1)
- (2)
- (1)
- (3)
- (4)
- (3,105)
- (1)
- (2,710)
- (2,716)
- (2,682)
- (2,678)
- (3,014)
- (2,687)
- (2,742)
- (2,736)
- (2,699)
- (2,680)
- (1,536)
- (2,808)
- (723)
- (723)
- (2,824)
- (1,511)
- (2,294)
- (7)
- (4)
- (369)
- (376)
- (369)
- (5)
- (2,376)
- (8)
- (1)
- (8,126)
- (3)
- (2,240)
- (2,203)
- (2,199)
- (1)
- (291)
- (163)
- (187)
- (178)
- (37)
- (58)
- (69,943)
- (990)
- (168)
- (4)
- (602)
- (101)
- (218)
- (14)
- (628)
- (27)
- (39)
- (144)
- (1)
- (1)
- (953)
- (6,382)
- (147)
- (5)
- (8)
- (1)
- (120)
- (671)
- (3)
- (16)
- (19)
- (2)
- (135)
- (212)
- (109)
- (3)
- (1)
- (6)
- (1)
- (15)
- (117)
- (633)
- (206)
- (2)
- (25)
- (14)
- (178)
- (102)
- (130)
- (1,480)
- (56)
- (1,878)
- (42,794)
- (32,324)
- (3,620)
- (1,385)
Filtrerede søgeresultater
Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
| Værtsarter | Rabbit |
|---|---|
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Fortynding | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Primær eller sekundær | Primary |
| Genadgangsnr. | P23946 |
| Klassifikation | Polyclonal |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Gene Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gensymboler | CMA1 |
| Applikationer | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Indhold og opbevaring | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS |
| Formulering | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 1215 |
| Testspecificitet | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Oprensningsmetode | Affinity Purified |
| Forskningsdisciplin | Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers |
Chymase/CMA1/Mast Cell Chymase Antibody (CC1), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 2 publications
| Klon | CC1 |
|---|---|
| Værtsarter | Mouse |
| Form | Purified |
| Konjugeret | Unconjugated |
| Isotype | IgG1 |
| Primær eller sekundær | Primary |
| Genadgangsnr. | P23946 |
| Klassifikation | Monoclonal |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Gene Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gensymboler | CMA1 |
| Indhold og opbevaring | Store at 4C. Do not freeze. |
| Immunogen | BALB/C mice were injected with a purified human skin chymase. |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 1215 |
| Testspecificitet | This reacts with mast cells distributed in skin, synovium, lung and heart. |
| Oprensningsmetode | Protein A or G purified |
| Forskningsdisciplin | Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers |
L1 Cell Adhesion Molecule Ab-1 Mouse Monoclonal Antibody, Epredia™
Recommended for Immunohistochemistry (Formalin/paraffin), Western Blotting and Immunoprecipitation (Native and denatured), Epredia™ L1 Cell Adhesion Molecule Ab-1, Mouse Monoclonal Antibody provides accurate, reproducible results.
| Primær eller sekundær | Primary |
|---|---|
| Klassifikation | Monoclonal |
| Antigen | L1 Cell Adhesion Molecule Ab-1 |
| Klon | UJ127 |
| Værtsarter | Mouse |
| Applikationer | Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot |
| Immunogen | Homogenous suspension of 16 week human fetal brain |
| Isotype | IgG2a κ |
| Målarter | Human |
| Regulatorisk status | RUO |
| Forskningsdisciplin | Cancer and Tumor Biology |
| Klon | MCG35 |
|---|---|
| Værtsarter | Mouse |
| Form | Purified |
| Konjugeret | Unconjugated |
| Isotype | IgG1 κ |
| Koncentration | 1 mg/mL |
| Fortynding | Immunohistochemistry 1:10 - 1:500 |
| Primær eller sekundær | Primary |
| Klassifikation | Monoclonal |
| Antigen | Mast Cell Marker |
| Applikationer | Immunohistochemistry |
| Indhold og opbevaring | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunogen | Spleen cells and bone marrow cells (erythrocyte depleted) from a patient with systemic mastocytosis. The bone marrow preparation consisted of 50% typical mast cells. |
| Formulering | PBS |
| Målarter | Human |
| Regulatorisk status | RUO |
| Oprensningsmetode | Protein A purified |
| Forskningsdisciplin | Cardiovascular Biology |
Epredia™ Lab Vision™ Desmin (Muscle Cell Marker) Ab-1, Mouse Monoclonal Antibody
Specifically detect desmin in human, baboon, monkey, cow, cat, dog, hamster, rat and chicken samples.
| Primær eller sekundær | Primary |
|---|---|
| Klassifikation | Monoclonal |
| Antigen | Desmin (Muscle Cell Marker) Ab-1 |
| Klon | D33 |
| Værtsarter | Mouse |
| Applikationer | Immunofluorescence,Immunohistochemistry (Paraffin) |
| Konjugeret | Unconjugated |
| Immunogen | Desmin from human muscle |
| Regulatorisk status | IVD |
| Forskningsdisciplin | Muscle Biology |
CD31/PECAM-1 (Endothelial Cell Marker) Rabbit Polyclonal Antibody, Epredia™
Ensure accurate, reproducible results in immunohistochemistry procedures with Epredia™ CD31/PECAM-1 (Endothelial Cell Marker), Rabbit Polyclonal Antibody.
| Primær eller sekundær | Primary |
|---|---|
| Klassifikation | Polyclonal |
| Antigen | CD31 (Endothelial Cell Marker) |
| Værtsarter | Rabbit |
| Applikationer | Immunohistochemistry (Paraffin) |
| Konjugeret | Unconjugated |
| Immunogen | Synthetic peptide corresponding to C-terminus of mouse CD31 protein |
| Målarter | Human |
| Regulatorisk status | RUO |
| Oprensningsmetode | Tonsil |
| Forskningsdisciplin | Cancer and Tumor Biology |
Panendothelial Cell Antigen Antibody (MECA-32), Alexa Fluor™ 488, Novus Biologicals™
Rat Monoclonal Antibody
| Klon | MECA-32 |
|---|---|
| Værtsarter | Rat |
| Form | Purified |
| Konjugeret | Alexa Fluor 488 |
| Isotype | IgG2a κ |
| Primær eller sekundær | Primary |
| Klassifikation | Monoclonal |
| Antigen | Panendothelial Cell Antigen |
| Gene Alias | FELS, Fenestrated endothelial-linked structure protein, gp68, MECA32, MECA-32, Panendothelial Cell Antigen, plasmalemma vesicle associated protein, Plasmalemma Vesicle Protein 1, PV-1 protein |
| Applikationer | Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry/Immunofluorescence,Immunoprecipitation |
| Indhold og opbevaring | Store at 4°C in the dark. |
| Immunogen | Mouse lymph node stromal cells. |
| Formulering | 50mM Sodium Borate |
| Målarter | Human,Mouse |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 84094 |
| Oprensningsmetode | Protein G purified |
| Forskningsdisciplin | Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Extracellular Matrix, Hypoxia, Immunology, Mesenchymal Stem Cell Markers, Stem Cell Markers |
Renal Cell Carcinoma Marker (gp200) Ab-1 Mouse Monoclonal Antibody, Epredia™
Provide accurate, reproducible results with the Epredia™ Renal Cell Carcinoma Marker (gp200) Ab-1, Mouse Monoclonal Antibody.
| Primær eller sekundær | Primary |
|---|---|
| Klassifikation | Monoclonal |
| Antigen | Renal Cell Carcinoma Marker (gp200) Ab-1 |
| Klon | PN-15 |
| Værtsarter | Mouse |
| Applikationer | Immunohistochemistry (Paraffin),Western Blot |
| Immunogen | Microsomal fraction of human renal cortical tissue homogenate |
| Regulatorisk status | IVD |
| Forskningsdisciplin | Cancer and Tumor Biology |
Chymase/CMA1/Mast Cell Chymase Rabbit anti-Human, Mouse, Rat, Clone: 2O4P8, Novus Biologicals™
Rabbit Monoclonal Antibody
| Klon | 2O4P8 |
|---|---|
| Værtsarter | Rabbit |
| Form | Purified |
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Fortynding | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Primær eller sekundær | Primary |
| Klassifikation | Monoclonal |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Gene Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Applikationer | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Indhold og opbevaring | Store at -20°C. Avoid freeze-thaw cycles. |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN |
| Formulering | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Målarter | Human,Mouse,Rat |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 1215 |
| Oprensningsmetode | Affinity purified |
| Forskningsdisciplin | Cell Biology, Cellular Markers, Immunology, Innate Immunity, Mast Cell Markers |
Epredia™ Lab Vision™ CD3 (Early T-Cell Marker) Rabbit Monoclonal Antibody,
Stain normal and neoplastic T cells in formalin-fixed, paraffin-embedded tissues with Epredia™ CD3 (Early T-Cell Marker), Rabbit Monoclonal Antibody.
| Primær eller sekundær | Primary |
|---|---|
| Klassifikation | Monoclonal |
| Antigen | CD3 |
| Klon | SP7 |
| Værtsarter | Rabbit |
| Applikationer | Immunohistochemistry (Paraffin) |
| Konjugeret | Unconjugated |
| Immunogen | A synthetic 13-mer peptide corresponding to aa 156-168 of the epsilon-chain of human CD3 protein |
| Regulatorisk status | IVD |
| Forskningsdisciplin | Cancer and Tumor Biology |