missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
-Immunohistochemistry-Paraffin-NBP3-15389-img0001.jpg-650.jpg)
-Western-Blot-NBP3-15389-img0002.jpg-650.jpg)
Chymase/CMA1/Mast Cell Chymase Rabbit anti-Human, Mouse, Rat, Clone: 2O4P8, Novus Biologicals™
Rabbit Monoclonal Antibody
1535.00 DKK - 3875.00 DKK
Tekniske data
| Antigen | Chymase/CMA1/Mast Cell Chymase |
|---|---|
| Klon | 2O4P8 |
| Fortynding | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applikationer | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Monoclonal |
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|
18329381
|
Bio-Techne
NBP3-15389-20UL |
20 μg |
1535.00 DKK
20µL |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
|
18086144
|
Novus Biologicals
NBP3-15389-100UL |
100 μg |
3875.00 DKK
100µL |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
Beskrivelse
Chymase/CMA1/Mast Cell Chymase Monoclonal antibody specifically detects Chymase/CMA1/Mast Cell Chymase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Tekniske data
| Chymase/CMA1/Mast Cell Chymase | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 | |
| A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 2O4P8 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers, Immunology, Innate Immunity, Mast Cell Markers | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 1215 | |
| IgG | |
| Affinity purified |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel