Antistoffer er glycoproteiner, der tjener en væsentlig rolle i immunsystemet for at beskytte dyr mod infektion eller de cytotoksiske virkninger af fremmede forbindelser ved at binde med høj affinitet til invasive molekyler; klassificeret som primær eller sekundær.
Synthetic peptides corresponding to CNTNAP3(contactin associated protein-like 3) The peptide sequence was selected from the middle region of CNTNAP3. Peptide sequence GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA.
Synthetic peptides corresponding to C1ORF75 The peptide sequence was selected from the N terminal of C1ORF75. Peptide sequence IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP.
Synthetic peptides corresponding to MICA(MHC class I polypeptide-related sequence A) The peptide sequence was selected from the N terminal of MICA. Peptide sequence LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ.
Synthetic peptides corresponding to TMEM75(transmembrane protein 75) The peptide sequence was selected from the C terminal of TMEM75. Peptide sequence VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS.
chromosome 1 open reading frame 174, RP13-531C17.2
Gensymboler
C1ORF174
Applikationer
Western Blot
Immunogen
Synthetic peptides corresponding to C1ORF174 The peptide sequence was selected from the middle region of C1ORF174. Peptide sequence EAGVSVQQGAASLPLGGCRVVSDSRLAKTRDGLSVPKHSAGSGAEESNSS.
Synthetic peptides corresponding to CES7(carboxylesterase 7) The peptide sequence was selected from the N terminal of CES7. Peptide sequence SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP.