Primære antistoffer
Primære antistoffer er immunglobuliner, der genkender og binder til et specifikt antigen af interesse med høj affinitet og specificitet til at oprense, detektere og måle dette antigen. Indeholder antistofpar til specifikke biokemiske anvendelser.
Filtrerede søgeresultater
Produkter fra nogle af vores leverandører vises ikke i filtrerede søgeresultater.
ryd alle filtre
for at se disse produkter.
1
–
15
af
6,371
Resultater
Invitrogen™ La Crosse Virus Monoclonal Antibody (8C2.2)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ La Crosse Virus Monoclonal Antibody (10G5.4)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ L-Selectin (CD62L) Chimeric Recombinant Rabbit Monoclonal Antibody (DREG-56)
Rabbit Recombinant Monoclonal Antibody
Invitrogen™ L-Selectin (CD62L) Recombinant Mouse Monoclonal Antibody (DREG-56)
Mouse Recombinant Monoclonal Antibody
| Værtsarter | Rabbit |
|---|---|
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Primær eller sekundær | Primary |
| Genadgangsnr. | NP_689569 |
| Klassifikation | Polyclonal |
| Antigen | ZNF491 |
| Gene Alias | FLJ34791, MGC126639, zinc finger protein 491 |
| Gensymboler | ZNF491 |
| Applikationer | Western Blot |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF491. Peptide Sequence: SFNRNIRTDTGHQPHKCQKFLEKPYKHKQRRKALSHSHCFRTHERPHTRE |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 126069 |
| Molekylvægt af antigen | 51 kDa |
| Værtsarter | Rabbit |
|---|---|
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Primær eller sekundær | Primary |
| Genadgangsnr. | NP_848653 |
| Klassifikation | Polyclonal |
| Antigen | ZNF680 |
| Gene Alias | FLJ90430, zinc finger protein 680 |
| Gensymboler | ZNF680 |
| Applikationer | Western Blot |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF680. Peptide sequence: RGYGKCGHENLQLRISCKSVDESKVFKEGYNELNQCLRTTQSKIFQCDKY |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 340252 |
| Molekylvægt af antigen | 62 kDa |
| Værtsarter | Rabbit |
|---|---|
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Primær eller sekundær | Primary |
| Genadgangsnr. | NP_997203 |
| Klassifikation | Polyclonal |
| Antigen | OTUD6A |
| Gene Alias | DUBA2, DUBA-2, OTU domain containing 6A |
| Gensymboler | OTUD6A |
| Applikationer | Western Blot |
| Immunogen | Synthetic peptide directed towards the N terminal of human OTUD6A. Peptide sequence MEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRER. |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 139562 |
| Molekylvægt af antigen | 32 kDa |
| Værtsarter | Rabbit |
|---|---|
| Form | Purified |
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Primær eller sekundær | Primary |
| Genadgangsnr. | NP_149990 |
| Klassifikation | Polyclonal |
| Antigen | ZNF670 |
| Gene Alias | FLJ12606, MGC12466, zinc finger protein 670 |
| Gensymboler | ZNF670 |
| Applikationer | Western Blot |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF670. Peptide sequence EDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVS. |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 93474 |
| Molekylvægt af antigen | 45 kDa |
| Oprensningsmetode | Protein A purified |
| Værtsarter | Rabbit |
|---|---|
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Primær eller sekundær | Primary |
| Genadgangsnr. | NP_653295 |
| Klassifikation | Polyclonal |
| Antigen | ZNF570 |
| Gene Alias | zinc finger protein 570 |
| Gensymboler | ZNF570 |
| Applikationer | Western Blot |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF570. Peptide sequence QGKAPWMVKRELTKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETLTS. |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 148268 |
| Molekylvægt af antigen | 62 kDa |
| Værtsarter | Rabbit |
|---|---|
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Primær eller sekundær | Primary |
| Genadgangsnr. | NP_689688 |
| Klassifikation | Polyclonal |
| Antigen | ZNF417 |
| Gene Alias | MGC34079, zinc finger protein 417 |
| Gensymboler | ZNF417 |
| Applikationer | Western Blot |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF417. Peptide Sequence: HQETHHKQKLNRSGACGKNLDDTAYLHQHQKQHIGEKFYRKSVREASFVK |
| Målarter | Human |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 147687 |
| Molekylvægt af antigen | 66 kDa |