missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
ISX Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79216-100UL
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
ISX Polyclonal specifically detects ISX in Human samples. It is validated for Western Blot.
Tekniske data
| ISX | |
| Polyclonal | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| intestine-specific homeobox, RAXLX | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 91464 | |
| Human | |
| IgG |
| Western Blot | |
| LYOPH | |
| Western Blot 1:1000 | |
| NP_001008494 | |
| ISX | |
| Synthetic peptide directed towards the N terminal of human ISXThe immunogen for this antibody is ISX. Peptide sequence ILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRKSKRRV. | |
| 100 μL | |
| Primary | |
| Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution. | |
| Store at -20C. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
RUO
Ser du en mulighed for forbedring?Del en indholdskorrektion