missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
OTUD6A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91497
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
OTUD6A Polyclonal specifically detects OTUD6A in Human samples. It is validated for Western Blot.
Spécification
| OTUD6A | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| DUBA2, DUBA-2, OTU domain containing 6A | |
| Rabbit | |
| 32 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_997203 | |
| OTUD6A | |
| Synthetic peptide directed towards the N terminal of human OTUD6A. Peptide sequence MEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRER. | |
| Affinity purified | |
| RUO | |
| 139562 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu