missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
ZNF570 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80143
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
ZNF570 Polyclonal specifically detects ZNF570 in Human samples. It is validated for Western Blot.
Tekniske data
| ZNF570 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| zinc finger protein 570 | |
| Rabbit | |
| 62 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_653295 | |
| ZNF570 | |
| Synthetic peptide directed towards the N terminal of human ZNF570. Peptide sequence QGKAPWMVKRELTKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETLTS. | |
| Affinity purified | |
| RUO | |
| 148268 | |
| Human | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion