Søgeresultatside | Fisher Scientific

Bio-Techne (204)
Novus Biologicals (57,951)
R&D Systems (34)

specielle programmer

Greener Choice (14)

Proteintilstand

Denatured (2)
Native (14,849)

Rekombinant

Native (1)
Recombinant (2,423)

Værtsarter

Canine (2)
Chicken (2)
Goat (3)
Human (499)
Mouse (233)
Non-species Specific (1)
Primate (5)
Rabbit (238)
Rat (22)

Form

Ascites (2)
Liquid (3)
Lyophilized (2)
Purified (591)

1 – 15 af 50,343 Resultater

R&D Systems™ Human Thrombospondin-1 Quantikine ELISA Kit

Human Thrombospondin-1 Quantikine ELISA Kit from the most referenced ELISA manufacturer. Highly validated for accurate quantitation and long-term reproducibility.

Pris og tilgængelighed

Life Science Research ELISA Kits

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Highly purified and high bioactivity. Generating reliable and reproducible results.

Pris og tilgængelighed
Tekniske data

Rekombinante proteiner

Rekombinant	Recombinant
Konjugeret	Unconjugated
Gen symbol	SNCA
Navn	Human alpha-Synuclein Aggregate Protein
Krydsreaktivitet	Human
Gene Alias	alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Produkttype	Recombinant Protein
Immunogen	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Regulatorisk status	RUO
Formulering	PBS
Gen-id (Entrez)	6622
Kilde	E.Coli
Oprensningsmetode	>95% pure by SDS-PAGE
Til brug med (applikation)	In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot

Novus Biologicals™ Mouse Brain Whole Tissue Lysate (Adult Whole Normal)

Pris og tilgængelighed

Vævslysater

Novus Biologicals™ Recombinant Human MBL His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pris og tilgængelighed
Tekniske data

Rekombinante proteiner

Rekombinant	Recombinant
Konjugeret	Unconjugated
Adgangsnummer	NP_000233
Arter	Human
Regulatorisk status	RUO
Gen-id (Entrez)	4153
Kilde	E. Coli
Oprensningsmetode	SDS-PAGE
Navn	MBL Protein
Til brug med (applikation)	SDS-PAGE

Novus Biologicals™ Recombinant Human TOP2A GST (N-Term) Protein

Recombinant Protein

Pris og tilgængelighed
Tekniske data

Rekombinante proteiner

Gene Alias	DNA topoisomerase (ATP-hydrolyzing), DNA topoisomerase 2-alpha, DNA topoisomerase II, 170 kD, DNA topoisomerase II, alpha isozyme, EC 5.99.1.3, TOP2DNA gyrase, topoisomerase (DNA) II alpha (170kD), topoisomerase (DNA) II alpha 170kDa, TP2A
Molekylvægt (g/mol)	36.41 kDa
Opbevaringskrav	Store at -80°C. Avoid freeze-thaw cycles.
Gen symbol	TOP2A
Formulering	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Renhed eller kvalitetsklasse	>80% by SDS-PAGE and Coomassie blue staining
Gen-id (Entrez)	7153
Forskningskategori	Cancer, Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Stem Cell Markers
Protein	TOP2A
Til brug med (applikation)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification

Novus Biologicals™ Recombinant Human SRPR alpha GST (N-Term) Protein

Recombinant Protein

Pris og tilgængelighed

Rekombinante proteiner

Novus Biologicals™ Recombinant Human 5-HT1E GST (N-Term) Protein

Recombinant Protein

Pris og tilgængelighed
Tekniske data

Rekombinante proteiner

Gene Alias	5-HT-1E, 5-hydroxytryptamine (serotonin) receptor 1E, S31,5-HT1E5-hydroxytryptamine receptor 1E, Serotonin receptor 1E
Molekylvægt (g/mol)	33.55 kDa
Opbevaringskrav	Store at -80°C. Avoid freeze-thaw cycles.
Gen symbol	HTR1E
Formulering	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Renhed eller kvalitetsklasse	>80% by SDS-PAGE and Coomassie blue staining
Gen-id (Entrez)	3354
Forskningskategori	GPCR
Protein	5-HT1E
Til brug med (applikation)	Western Blot,ELISA,PAGE,Protein Array,Immunoaffinity Purification

Novus Biologicals™ AUF1 Overexpression Lysate

Pris og tilgængelighed

Overexpression Lysates

Novus Biologicals™ ORAOV1 Overexpression Lysate

Pris og tilgængelighed

Overexpression Lysates

Novus Biologicals™ TMPPE Overexpression Lysate

Pris og tilgængelighed

Overexpression Lysates

Novus Biologicals™ Recombinant Human ZNF614 GST (N-Term) Protein

Recombinant Protein

Pris og tilgængelighed
Tekniske data

Rekombinante proteiner

Gene Alias	FLJ21941, MGC120638, zinc finger protein 614
Molekylvægt (g/mol)	MolecularWeight-theroretical: 49.2 kDa
Opbevaringskrav	Store at -80°C. Avoid freeze/thaw cycles.
Gen symbol	ZNF614
Formulering	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Renhed eller kvalitetsklasse	>80% by SDS-PAGE and Coomassie blue staining
Gen-id (Entrez)	80110
Protein	ZNF614
Til brug med (applikation)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification

Novus Biologicals™ Cytochrome P450 4F11 Overexpression Lysate

Pris og tilgængelighed

Overexpression Lysates

Novus Biologicals™ Recombinant Human FBXL7 GST (N-Term) Protein

Recombinant Protein

Pris og tilgængelighed
Tekniske data

Rekombinante proteiner

Gene Alias	FBL7FBL6F-box protein Fbl7, F-box and leucine-rich repeat protein 7F-box protein FBL6/FBL7, F-box/LRR-repeat protein 7, KIAA0840
Molekylvægt (g/mol)	36.52 kDa
Opbevaringskrav	Store at -80°C. Avoid freeze-thaw cycles.
Gen symbol	FBXL7
Formulering	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Renhed eller kvalitetsklasse	>80% by SDS-PAGE and Coomassie blue staining
Gen-id (Entrez)	23194
Protein	FBXL7
Til brug med (applikation)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification

Novus Biologicals™ Recombinant Human COL1A2 GST (N-Term) Protein

Recombinant Protein

Pris og tilgængelighed
Tekniske data

Rekombinante proteiner

Gene Alias	alpha 2(I)-collagen, Alpha-2 type I collagen, collagen alpha-2(I) chain, collagen I, alpha-2 polypeptide, collagen of skin, tendon and bone, alpha-2 chain, collagen, type I, alpha 2, OI4, osteogenesis imperfecta type IV, type I procollagen
Molekylvægt (g/mol)	M.W. (Theoretical): 37.95 kDa
Opbevaringskrav	Store at -80C. Avoid freeze-thaw cycles.
Gen symbol	COL1A2
Formulering	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Renhed eller kvalitetsklasse	>80% by SDS-PAGE and Coomassie blue staining
Gen-id (Entrez)	1278
Forskningskategori	Cell Biology, Cytoskeleton Markers, Signal Transduction, Stem Cells
Protein	COL1A2
Til brug med (applikation)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification

Novus Biologicals™ HMG-CoA Reductase/HMGCR Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Pris og tilgængelighed

Peptider

FORRIGE
1
2
3
4
5
6
...
3,357
NÆSTE

Filtrerede søgeresultater

Snævre resultater