missing translation for 'onlineSavingsMsg'
Få mere at vide

Novus Biologicals™ HMG-CoA Reductase/HMGCR Recombinant Protein Antigen

Artikelnummer. 18062948 Shop alle Bio Techne produkter
Klik for at se tilgængelige muligheder
Mængde:
0,1 ml
Pakningsstørrelse:
0.1ml
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 18062948

Brand: Novus Biologicals™ NBP191996PEP

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HMGCR. The HMG-CoA Reductase/HMGCR Recombinant Protein Antigen is derived from E. coli. The HMG-CoA Reductase/HMGCR Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-91996. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Tekniske data

Gen-id (Entrez) 3156
Arter Human
Oprensningsmetode Chromatography
Renhed >80%
Koncentration 0.5mg/mL
Indhold og opbevaring Store at -20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
Til brug med (applikation) Blocking/Neutralizing, Control
Gen symbol HMGCR
Etikettype Unlabeled
Molekylvægt (g/mol) 32kDa
Produkttype HMGCR
Mængde 0,1 ml
Regulatorisk status RUO
Kilde E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91996. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen MAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQG
Vis mere Vis mindre

For Research Use Only

Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.