accessibility menu, dialog, popup

UserName

Primære antistoffer

Primære antistoffer er immunglobuliner, der genkender og binder til et specifikt antigen af interesse med høj affinitet og specificitet til at oprense, detektere og måle dette antigen. Indeholder antistofpar til specifikke biokemiske anvendelser.
Alle primære antistoffer (5)

Filtrerede søgeresultater

Produkter fra nogle af vores leverandører vises ikke i filtrerede søgeresultater. ryd alle filtre for at se disse produkter.

Snævre resultater

Valgte filtre

Ryd alle

Keyword Search

insert vial

Snævre resultater

Snævre resultater

Ingen resultater fundet inden for denne kategori. Prøv at fjerne nogle valgte filtre, og prøv igen.

Kategori

Brands

  • (5)

Applikationer

  • (2)
  • (2)
  • (2)
  • (2)
  • (2)
  • (1)
  • (1)
Vis alle

Klassifikation

  • (2)
  • (3)

Konjugeret

  • (5)

Værtsarter

  • (2)
  • (3)

Isotype

  • (3)
  • (2)

Mængde

  • (2)
  • (3)

Regulatorisk status

  • (5)

Målarter

  • (3)
  • (3)
  • (3)
  • (1)
  • (3)
  • (5)
  • (3)
Vis alle

Form

  • (2)
1 – 5 af 5 Resultater
1

MMP-24/MT5-MMP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Primær eller sekundær Primary
Genadgangsnr. Q9Y5R2
Klassifikation Polyclonal
Antigen MMP-24/MT5-MMP
Gene Alias EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 24 (membrane-inserted), matrix metalloproteinase 24 (membrane-inserted), matrix metalloproteinase-24, membrane-type 5 matrix metalloproteinase, Membrane-type matrix metalloproteinase 5, Membrane-type-5 matrix metalloproteinase, MMP-24, MT5MMP, MT5-MMPMMP25, MT-MMP 5, MTMMP5, MT-MMP5
Gensymboler MMP24
Værtsarter Rabbit
Applikationer Western Blot
Konjugeret Unconjugated
Immunogen Synthetic peptides corresponding to MMP24(matrix metallopeptidase 24 (membrane-inserted)) The peptide sequence was selected from the middle region of MMP24 (NP_006681). Peptide sequence GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW.
Isotype IgG
Regulatorisk status RUO
Gen-id (Entrez) 10893
3

QTRT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Primær eller sekundær Primary
Genadgangsnr. Q80VS3
Klassifikation Polyclonal
Antigen QTRT1
Gene Alias EC 2.4.2.29, Guanine insertion enzyme, queuine tRNA-ribosyltransferase, queuine tRNA-ribosyltransferase 1, TGTFP3235, TGUT, tRNA-guanine transglycosylase
Gensymboler QTRT1
Værtsarter Rabbit
Applikationer Western Blot
Konjugeret Unconjugated
Isotype IgG
Regulatorisk status RUO
Gen-id (Entrez) 81890
4

VEGFR2/KDR/Flk-1 Antibody (20I6) - Azide and BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

Klon 20I6
Værtsarter Mouse
Form Purified
Konjugeret Unconjugated
Isotype IgG1
Koncentration LYOPH
Primær eller sekundær Primary
Klassifikation Monoclonal
Antigen VEGFR2/KDR/Flk-1
Gene Alias CD309, CD309 antigen, EC 2.7.10, EC 2.7.10.1, Fetal liver kinase 1, fetal liver kinase-1, FLK-1, FLK1tyrosine kinase growth factor receptor, Kinase insert domain receptor, kinase insert domain receptor (a type III receptor tyrosine kinase), Protein-tyrosine kinase receptor flk-1, soluble VEGFR2, vascular endothelial growth factor receptor 2, VEGFR, VEGFR2, VEGFR-2
Gensymboler KDR
Applikationer Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Frozen),CyTOF
Indhold og opbevaring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Målarter Human
Regulatorisk status RUO
Gen-id (Entrez) 3791
Testspecificitet The monoclonal antibody will detect native human VEGFR-2/KDR in ELISA experiments and on the surface of different human cell types.
Oprensningsmetode Protein G purified
Forskningsdisciplin Angiogenesis, Cancer, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, HIF Target Genes, Hypoxia, Stem Cell Markers, Tyrosine Kinases
5

VEGFR2/KDR/Flk-1 Antibody (4H3) - Azide and BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

Klon 4H3
Værtsarter Mouse
Form Purified
Konjugeret Unconjugated
Isotype IgG1
Koncentration LYOPH
Primær eller sekundær Primary
Genadgangsnr. P35968
Klassifikation Monoclonal
Antigen VEGFR2/KDR/Flk-1
Gene Alias CD309, CD309 antigen, EC 2.7.10, EC 2.7.10.1, Fetal liver kinase 1, fetal liver kinase-1, FLK-1, FLK1tyrosine kinase growth factor receptor, Kinase insert domain receptor, kinase insert domain receptor (a type III receptor tyrosine kinase), Protein-tyrosine kinase receptor flk-1, soluble VEGFR2, vascular endothelial growth factor receptor 2, VEGFR, VEGFR2, VEGFR-2
Gensymboler KDR
Applikationer Western Blot,Flow Cytometry,ELISA,Immunocytochemistry,Immunofluorescence,CyTOF
Indhold og opbevaring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Målarter Human
Regulatorisk status RUO
Gen-id (Entrez) 3791
Testspecificitet The monoclonal antibody will detect native human VEGFR-2/KDR on the surface of different human cell types.
Oprensningsmetode Protein G purified
Forskningsdisciplin Angiogenesis, Cancer, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, HIF Target Genes, Hypoxia, Stem Cell Markers, Tyrosine Kinases