missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
MMP-16/MT3-MMP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-69349
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
MMP-16/MT3-MMP Polyclonal specifically detects MMP-16/MT3-MMP in Human samples. It is validated for Western Blot.
Tekniske data
| MMP-16/MT3-MMP | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 8 open reading frame 57, DKFZp761D112, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 16 (membrane-inserted), matrix metalloproteinase 16 (membrane-inserted), matrix metalloproteinase-16, Membrane-type matrix metalloproteinase 3, Membrane-type-3 matrix metalloproteinase, MMP-16, MMPX2, MMP-X2, MT3MMP, MT3-MMPC8orf57, MT-MMP 3, MT-MMP2, MTMMP3, MT-MMP3, Putative transmembrane protein C8orf57 | |
| Rabbit | |
| 56 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P51512 | |
| MMP16 | |
| Synthetic peptides corresponding to MMP16(matrix metallopeptidase 16 (membrane-inserted)) The peptide sequence was selected from the N terminal of MMP16 (NP_005932). Peptide sequence ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA. | |
| Affinity purified | |
| RUO | |
| 4325 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion