Antistoffer

1 – 5 af 5 Resultater

Rabbit Polyclonal Antibody

Primær eller sekundær	Primary
Genadgangsnr.	Q9Y5R2
Klassifikation	Polyclonal
Antigen	MMP-24/MT5-MMP
Gene Alias	EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 24 (membrane-inserted), matrix metalloproteinase 24 (membrane-inserted), matrix metalloproteinase-24, membrane-type 5 matrix metalloproteinase, Membrane-type matrix metalloproteinase 5, Membrane-type-5 matrix metalloproteinase, MMP-24, MT5MMP, MT5-MMPMMP25, MT-MMP 5, MTMMP5, MT-MMP5
Gensymboler	MMP24
Værtsarter	Rabbit
Applikationer	Western Blot
Konjugeret	Unconjugated
Immunogen	Synthetic peptides corresponding to MMP24(matrix metallopeptidase 24 (membrane-inserted)) The peptide sequence was selected from the middle region of MMP24 (NP_006681). Peptide sequence GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW.
Isotype	IgG
Regulatorisk status	RUO
Gen-id (Entrez)	10893

Rabbit Polyclonal Antibody

Rabbit Polyclonal Antibody

Primær eller sekundær	Primary
Genadgangsnr.	Q80VS3
Klassifikation	Polyclonal
Antigen	QTRT1
Gene Alias	EC 2.4.2.29, Guanine insertion enzyme, queuine tRNA-ribosyltransferase, queuine tRNA-ribosyltransferase 1, TGTFP3235, TGUT, tRNA-guanine transglycosylase
Gensymboler	QTRT1
Værtsarter	Rabbit
Applikationer	Western Blot
Konjugeret	Unconjugated
Isotype	IgG
Regulatorisk status	RUO
Gen-id (Entrez)	81890

Mouse Monoclonal Antibody

Klon	20I6
Værtsarter	Mouse
Form	Purified
Konjugeret	Unconjugated
Isotype	IgG1
Koncentration	LYOPH
Primær eller sekundær	Primary
Klassifikation	Monoclonal
Antigen	VEGFR2/KDR/Flk-1
Gene Alias	CD309, CD309 antigen, EC 2.7.10, EC 2.7.10.1, Fetal liver kinase 1, fetal liver kinase-1, FLK-1, FLK1tyrosine kinase growth factor receptor, Kinase insert domain receptor, kinase insert domain receptor (a type III receptor tyrosine kinase), Protein-tyrosine kinase receptor flk-1, soluble VEGFR2, vascular endothelial growth factor receptor 2, VEGFR, VEGFR2, VEGFR-2
Gensymboler	KDR
Applikationer	Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Frozen),CyTOF
Indhold og opbevaring	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Målarter	Human
Regulatorisk status	RUO
Gen-id (Entrez)	3791
Testspecificitet	The monoclonal antibody will detect native human VEGFR-2/KDR in ELISA experiments and on the surface of different human cell types.
Oprensningsmetode	Protein G purified
Forskningsdisciplin	Angiogenesis, Cancer, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, HIF Target Genes, Hypoxia, Stem Cell Markers, Tyrosine Kinases

Mouse Monoclonal Antibody

Klon	4H3
Værtsarter	Mouse
Form	Purified
Konjugeret	Unconjugated
Isotype	IgG1
Koncentration	LYOPH
Primær eller sekundær	Primary
Genadgangsnr.	P35968
Klassifikation	Monoclonal
Antigen	VEGFR2/KDR/Flk-1
Gene Alias	CD309, CD309 antigen, EC 2.7.10, EC 2.7.10.1, Fetal liver kinase 1, fetal liver kinase-1, FLK-1, FLK1tyrosine kinase growth factor receptor, Kinase insert domain receptor, kinase insert domain receptor (a type III receptor tyrosine kinase), Protein-tyrosine kinase receptor flk-1, soluble VEGFR2, vascular endothelial growth factor receptor 2, VEGFR, VEGFR2, VEGFR-2
Gensymboler	KDR
Applikationer	Western Blot,Flow Cytometry,ELISA,Immunocytochemistry,Immunofluorescence,CyTOF
Indhold og opbevaring	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Målarter	Human
Regulatorisk status	RUO
Gen-id (Entrez)	3791
Testspecificitet	The monoclonal antibody will detect native human VEGFR-2/KDR on the surface of different human cell types.
Oprensningsmetode	Protein G purified
Forskningsdisciplin	Angiogenesis, Cancer, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, HIF Target Genes, Hypoxia, Stem Cell Markers, Tyrosine Kinases