missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
USP41 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
1555.00 DKK - 3520.00 DKK
Tekniske data
| Antigen | USP41 |
|---|---|
| Fortynding | Western Blot 1.0 ug/ml |
| Applikationer | Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|
18377505
|
Novus Biologicals
NBP3-09906-25UL |
25 μg |
1555.00 DKK
25µL |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
|
18345616
|
Novus Biologicals
NBP3-09906-100UL |
100 μg |
3520.00 DKK
100µL |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
Beskrivelse
USP41 Polyclonal specifically detects USP41 in Human samples. It is validated for Western Blot.Tekniske data
| USP41 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 373856 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of human USP41. Peptide sequence FFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQ | |
| Affinity purified |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel