missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
USP41 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09906-25UL
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
USP41 Polyclonal specifically detects USP41 in Human samples. It is validated for Western Blot.
Tekniske data
| USP41 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 373856 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of human USP41. Peptide sequence FFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQ | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion