missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
TMEM75 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3675.00 DKK
Tekniske data
| Antigen | TMEM75 |
|---|---|
| Applikationer | Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Værtsarter | Rabbit |
Beskrivelse
TMEM75 Polyclonal specifically detects TMEM75 in Human samples. It is validated for Western Blot.Tekniske data
| TMEM75 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ36105, transmembrane protein 75 | |
| TMEM75 | |
| IgG | |
| 15 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N9X5 | |
| 641384 | |
| Synthetic peptides corresponding to TMEM75(transmembrane protein 75) The peptide sequence was selected from the C terminal of TMEM75. Peptide sequence VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS. | |
| Primary |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel