missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
SNAP47 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3675.00 DKK
Tekniske data
| Antigen | SNAP47 |
|---|---|
| Applikationer | Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Værtsarter | Rabbit |
Beskrivelse
SNAP47 Polyclonal specifically detects SNAP47 in Human samples. It is validated for Western Blot.Tekniske data
| SNAP47 | |
| Polyclonal | |
| Rabbit | |
| Q5SQN1 | |
| 116841 | |
| Synthetic peptides corresponding to C1ORF142 The peptide sequence was selected from the middle region of C1ORF142 (NP_444280). Peptide sequence TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C1orf142, Epididymis luminal protein 170, FLJ12517, HEL170, SNAP-47chromosome 1 open reading frame 142, SVAP1DKFZp686M10160, Synaptosomal-associated 47 kDa protein, synaptosomal-associated protein 47, synaptosomal-associated protein, 47kDa | |
| SNAP47 | |
| IgG | |
| 52.5 kDa |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel