missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
SNAP29 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79769
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
SNAP29 Polyclonal specifically detects SNAP29 in Rat samples. It is validated for Western Blot.
Tekniske data
| SNAP29 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CEDNIKSoluble 29 kDa NSF attachment protein, SNAP-29FLJ21051, synaptosomal-associated protein 29, synaptosomal-associated protein, 29kD, synaptosomal-associated protein, 29kDa, Vesicle-membrane fusion protein SNAP-29 | |
| Rabbit | |
| 29 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Dog: 85%; Pig: 85%; Horse: 85%; Guinea pig: 85%; Rabbit: 77%. | |
| Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_446262 | |
| SNAP29 | |
| The immunogen for this antibody is Snap29. Peptide sequence NSIKSVFGGFINYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKDQESK. | |
| Affinity purified | |
| RUO | |
| 9342 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion