Learn More
Abnova™ S100A9 Recombinant Protein
Human S100A9 full-length ORF recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00006280-P01.25ug
Description
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis.
- Theoretical MW (kDa): 38.28
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH47681 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
38.28 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25 μg | |
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP | |
60B8AG/CAGB/CFAG/CGLB/L1AG/LIAG/MAC387/MIF/MRP14/NIF/P14 | |
S100A9 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
6280 | |
S100A9 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
S100A9 | |
Human | |
Recombinant | |
Solution |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.