missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ S100A9 Recombinant Protein

Human S100A9 full-length ORF recombinant protein with GST-tag at N-terminal

2735.00 DKK - 4200.00 DKK

Specifications

Accession Number	AAH47681
For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez)	6280
Molecular Weight (g/mol)	38.28

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16130472 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00006280-P01.10ug	10 μg	2735.00 DKK 10µg		Please sign in to purchase this item. Need a web account? Register with us today!

16140472 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00006280-P01.25ug	25 μg	4200.00 DKK 25µg		Please sign in to purchase this item. Need a web account? Register with us today!

Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis.

Theoretical MW (kDa): 38.28
Preparation method: In vitro wheat germ expression system
Purification: Glutathione Sepharose 4 fast flow
Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH47681
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	38.28
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	S100A9
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	6280
Name	S100A9 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Gene Alias	60B8AG/CAGB/CFAG/CGLB/L1AG/LIAG/MAC387/MIF/MRP14/NIF/P14
Gene Symbol	S100A9
Species	Wheat Germ (in vitro)
Protein Tag	GST

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ S100A9 Recombinant Protein

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ S100A9 Recombinant Protein

Specifications

Description

Specifications

Documents