missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
RAB11FIP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3675.00 DKK
Tekniske data
| Antigen | RAB11FIP5 |
|---|---|
| Applikationer | Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Værtsarter | Rabbit |
Beskrivelse
RAB11FIP5 Polyclonal specifically detects RAB11FIP5 in Human samples. It is validated for Western Blot.Tekniske data
| RAB11FIP5 | |
| Polyclonal | |
| Rabbit | |
| NP_056285 | |
| 26056 | |
| Synthetic peptide directed towards the N terminal of human RAB11FIP5The immunogen for this antibody is RAB11FIP5. Peptide sequence MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp434H018, Gaf-1, GAF1rab11-FIP5, Gamma-SNAP-associated factor 1, KIAA0857gaf-1, Phosphoprotein pp75, pp75, RAB11 family interacting protein 5 (class I), Rab11-FIP5, Rab11-interacting protein Rip11, RAB11RIP5, RIP11rab11 family-interacting protein 5 | |
| RAB11FIP5 | |
| IgG | |
| 70 kDa |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel