missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
RAB11FIP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79582
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
RAB11FIP5 Polyclonal specifically detects RAB11FIP5 in Human samples. It is validated for Western Blot.
Tekniske data
| RAB11FIP5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp434H018, Gaf-1, GAF1rab11-FIP5, Gamma-SNAP-associated factor 1, KIAA0857gaf-1, Phosphoprotein pp75, pp75, RAB11 family interacting protein 5 (class I), Rab11-FIP5, Rab11-interacting protein Rip11, RAB11RIP5, RIP11rab11 family-interacting protein 5 | |
| Rabbit | |
| 70 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_056285 | |
| RAB11FIP5 | |
| Synthetic peptide directed towards the N terminal of human RAB11FIP5The immunogen for this antibody is RAB11FIP5. Peptide sequence MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV. | |
| Affinity purified | |
| RUO | |
| 26056 | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Guinea Pig, Rabbit | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion