missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
MMP-24/MT5-MMP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3540.00 DKK
Tekniske data
| Antigen | MMP-24/MT5-MMP |
|---|---|
| Applikationer | Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Værtsarter | Rabbit |
Beskrivelse
MMP-24/MT5-MMP Polyclonal specifically detects MMP-24/MT5-MMP in Human samples. It is validated for Western Blot.Tekniske data
| MMP-24/MT5-MMP | |
| Polyclonal | |
| Rabbit | |
| Q9Y5R2 | |
| 10893 | |
| Synthetic peptides corresponding to MMP24(matrix metallopeptidase 24 (membrane-inserted)) The peptide sequence was selected from the middle region of MMP24 (NP_006681). Peptide sequence GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 24 (membrane-inserted), matrix metalloproteinase 24 (membrane-inserted), matrix metalloproteinase-24, membrane-type 5 matrix metalloproteinase, Membrane-type matrix metalloproteinase 5, Membrane-type-5 matrix metalloproteinase, MMP-24, MT5MMP, MT5-MMPMMP25, MT-MMP 5, MTMMP5, MT-MMP5 | |
| MMP24 | |
| IgG |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel