missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
LARP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
1410.00 DKK - 4095.00 DKK
Tekniske data
| Antigen | LARP1 |
|---|---|
| Fortynding | Western Blot 1:500 - 1:2000, ELISA |
| Applikationer | ELISA, Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|
30227092
|
Novus Biologicals
NBP3-38102-100ul |
100 μL |
4095.00 DKK
100µL |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
|
30230902
|
Novus Biologicals
NBP3-38102-20ul |
20 μL |
1410.00 DKK
20µL |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
Beskrivelse
LARP1 Polyclonal antibody specifically detects LARP1 in Human samples. It is validated for ELISA,Western BlotTekniske data
| LARP1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| KIAA0731LARPMGC19556, La ribonucleoprotein domain family member 1, La ribonucleoprotein domain family, member 1, la-related protein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 106-205 of human LARP1 (Q6PKG0).,, Sequence:, AGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKD | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 23367 | |
| IgG | |
| Affinity purified |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel