missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
LARP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38102-20ul
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
LARP1 Polyclonal antibody specifically detects LARP1 in Human samples. It is validated for ELISA,Western Blot
Tekniske data
| LARP1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| KIAA0731LARPMGC19556, La ribonucleoprotein domain family member 1, La ribonucleoprotein domain family, member 1, la-related protein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 106-205 of human LARP1 (Q6PKG0).,, Sequence:, AGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKD | |
| 20 μL | |
| Primary | |
| Human | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 23367 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion