missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MSC Partial ORF (NP_005089.1, 103 a.a. - 188 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00009242-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is a transcriptional repressor capable of binding an E-box element either as a homodimer or as a heterodimer with E2A in vitro. The encoded protein also forms heterodimers with E2A proteins in vivo. This protein is capable of inhibiting the transactivation capability of E47, an E2A protein, in mammalian cells. This gene is a downstream target of the B-cell receptor signal transduction pathway. [provided by RefSeq]
Sequence: ECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRPSpecifications
| NP_005089.1 | |
| Liquid | |
| 9242 | |
| MSC (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ABF-1/ABF1/MYOR/bHLHa22 | |
| MSC | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.2kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| ECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRP | |
| RUO | |
| MSC | |
| Wheat Germ (in vitro) | |
| GST |