missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HIPK2 Partial ORF (AAG41236.1, 961 a.a. - 1065 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00028996-Q01.10ug
This item is not returnable.
View return policy
Description
HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.[supplied by OMIM]
Sequence: TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPTSpecifications
AAG41236.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.29kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT | |
RUO | |
HIPK2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
28996 | |
HIPK2 (Human) Recombinant Protein (Q01) | |
10 μg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DKFZp686K02111/FLJ23711/PRO0593 | |
HIPK2 | |
Recombinant | |
wheat germ expression system |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction