missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HIPK2 Partial ORF (AAG41236.1, 961 a.a. - 1065 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00028996-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16075455

  • 4040.00 DKK / 25µg
Estimated Shipment: 15-08-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.[supplied by OMIM]

Sequence: TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT
Specifications

Specifications

AAG41236.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.29kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT
RUO
HIPK2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
28996
HIPK2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp686K02111/FLJ23711/PRO0593
HIPK2
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers