missing translation for 'onlineSavingsMsg'
Learn More

CIITA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17818-25UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310596

  • 2756.95 DKK / 25µL
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

CIITA Polyclonal antibody specifically detects CIITA in Human samples. It is validated for Immunofluorescence
Specifications

Specifications

CIITA
Polyclonal
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
C2TA, C2TAMHC class II transactivator type III, CIITAIV, class II, major histocompatibility complex, transactivator, MHC class II transactivator, MHC2TANLR family, acid domain containing, NLRA, nucleotide-binding oligomerization domain, leucine rich repeat and acid domaincontaining
This antibody was developed against Recombinant Protein corresponding to amino acids: PEGPIQFVPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSMPEPALT
25 μg
Immunology
4261
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG
Immunofluorescence
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers