missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
CIITA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3055.00 DKK - 4920.00 DKK
Tekniske data
| Antigen | CIITA |
|---|---|
| Fortynding | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applikationer | Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|
18310596
|
Novus Biologicals
NBP3-17818-25UL |
25 μg |
3055.00 DKK
25µL |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
|
18333554
|
Novus Biologicals
NBP3-17818-100UL |
100 μg |
4920.00 DKK
100µL |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
Beskrivelse
CIITA Polyclonal antibody specifically detects CIITA in Human samples. It is validated for ImmunofluorescenceTekniske data
| CIITA | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Immunology | |
| PBS, pH 7.2, 40% glycerol | |
| 4261 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| C2TA, C2TAMHC class II transactivator type III, CIITAIV, class II, major histocompatibility complex, transactivator, MHC class II transactivator, MHC2TANLR family, acid domain containing, NLRA, nucleotide-binding oligomerization domain, leucine rich repeat and acid domaincontaining | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PEGPIQFVPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSMPEPALT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel