missing translation for 'onlineSavingsMsg'
Learn More

CIITA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

2885.00 DKK - 4530.00 DKK

Antigen	CIITA
Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Applications	Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18310596 View Documents missing translation for 'viewProductCertificates'	Bio-Techne NBP3-17818-25UL	25 μg	2885.00 DKK 25µL		Please sign in to purchase this item. Need a web account? Register with us today!

18333554 View Documents missing translation for 'viewProductCertificates'	Bio-Techne NBP3-17818-100UL	100 μg	4530.00 DKK 100µL		Please sign in to purchase this item. Need a web account? Register with us today!

Description

CIITA Polyclonal antibody specifically detects CIITA in Human samples. It is validated for Immunofluorescence

Specifications

Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	C2TA, C2TAMHC class II transactivator type III, CIITAIV, class II, major histocompatibility complex, transactivator, MHC class II transactivator, MHC2TANLR family, acid domain containing, NLRA, nucleotide-binding oligomerization domain, leucine rich repeat and acid domaincontaining
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: PEGPIQFVPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSMPEPALT
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Description