missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Chymase/CMA1/Mast Cell Chymase Rabbit anti-Human, Mouse, Rat, Clone: 2O4P8, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Bio-Techne NBP3-15389-20UL
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
Chymase/CMA1/Mast Cell Chymase Monoclonal antibody specifically detects Chymase/CMA1/Mast Cell Chymase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Tekniske data
| Chymase/CMA1/Mast Cell Chymase | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 2O4P8 | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 | |
| A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN | |
| 20 μg | |
| Cell Biology, Cellular Markers, Immunology, Innate Immunity, Mast Cell Markers | |
| 1215 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion