missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
CES7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3540.00 DKK
Tekniske data
| Antigen | CES7 |
|---|---|
| Applikationer | Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Værtsarter | Rabbit |
Beskrivelse
CES7 Polyclonal specifically detects CES7 in Human samples. It is validated for Western Blot.Tekniske data
| CES7 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 221223 | |
| Synthetic peptides corresponding to CES7(carboxylesterase 7) The peptide sequence was selected from the N terminal of CES7. Peptide sequence SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| carboxylesterase 5A, carboxylesterase 7, CAUXIN, FLJ31547 | |
| CES5A | |
| IgG | |
| 58 kDa |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel