missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CD3Z Recombinant Protein
Human CD3Z full-length ORF recombinant protein with GST-tag at N-terminal
2665.00 DKK - 4040.00 DKK
Specifications
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
|---|---|
| Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Molecular Weight (g/mol) | 43.78 |
| pH Range | 8 |
| Preparation Method | In vitro wheat germ expression system |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16132781
|
Abnova™
H00000919-P01.10UG |
10 ug |
2665.00 DKK
10µg |
Estimated Shipment: 18-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16142781
|
Abnova™
H00000919-P01.25UG |
25μg |
4040.00 DKK
25µg |
Estimated Shipment: 18-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
The protein encoded by this gene is T-cell receptor ζ, which together with T-cell receptor α/β and γ/δ heterodimers, and with CD3-γ, -δ and -ε, forms the T-cell receptor-CD3 complex. The ζ chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Theoretical MW (kDa): 43.78
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 43.78 | |
| In vitro wheat germ expression system | |
| Wheat Germ (in vitro) | |
| Recombinant |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Human | |
| Solution |