Learn More
Abnova™ CD3Z Recombinant Protein
Human CD3Z full-length ORF recombinant protein with GST-tag at N-terminal
2735.00 DKK - 4145.00 DKK
Specifications
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
---|---|
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Molecular Weight (g/mol) | 43.78 |
pH Range | 8 |
Preparation Method | In vitro wheat germ expression system |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16132781
|
Abnova™
H00000919-P01.10ug |
10 ÎĽg |
2735.00 DKK
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
16142781
|
Abnova™
H00000919-P01.25ug |
25 ÎĽg |
4145.00 DKK
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
The protein encoded by this gene is T-cell receptor ζ, which together with T-cell receptor α/β and γ/δ heterodimers, and with CD3-γ, -δ and -ε, forms the T-cell receptor-CD3 complex. The ζ chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Theoretical MW (kDa): 43.78
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
Antibody Production, Protein Array, ELISA, Western Blot | |
43.78 | |
In vitro wheat germ expression system | |
Wheat Germ (in vitro) | |
Recombinant |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Human | |
Solution |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.