Få mere at vide
Abnova™ CD3Z Recombinant Protein
Beskrivelse
The protein encoded by this gene is T-cell receptor ζ, which together with T-cell receptor α/β and γ/δ heterodimers, and with CD3-γ, -δ and -ε, forms the T-cell receptor-CD3 complex. The ζ chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Theoretical MW (kDa): 43.78
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Tekniske data
Tekniske data
| Adgangsnummer | AAH25703 |
| Til brug med (applikation) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulering | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gen-id (Entrez) | 919 |
| Molekylvægt (g/mol) | 43.78 |
| Navn | CD3Z (Human) Recombinant Protein (P01) |
| pH-område | 8 |
| Fremstillingsmetode | In vitro wheat germ expression system |
| Oprensningsmetode | Glutathione Sepharose 4 Fast Flow |
| Kvalitetskontrol test | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Vis mere |
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.