missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
ARPM1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3505.00 DKK
Tekniske data
| Antigen | ARPM1 |
|---|---|
| Fortynding | Western Blot 1.0 ug/ml |
| Applikationer | Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
Beskrivelse
ARPM1 Polyclonal specifically detects ARPM1 in Mouse samples. It is validated for Western Blot.Tekniske data
| ARPM1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| actin related protein M1, actin-related protein M1, MGC15664 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of mouse ARPM1 (NP_083966.1). Peptide sequence DVAKLAPANTAVQVIAPPERKISVWMGGSILASLSAFQDMWITAAEFEEV | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 84517 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel