missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
ARPM1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10848-100UL
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
ARPM1 Polyclonal specifically detects ARPM1 in Mouse samples. It is validated for Western Blot.
Tekniske data
| ARPM1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| actin related protein M1, actin-related protein M1, MGC15664 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of mouse ARPM1 (NP_083966.1). Peptide sequence DVAKLAPANTAVQVIAPPERKISVWMGGSILASLSAFQDMWITAAEFEEV | |
| 100 μg | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 84517 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion