missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARPM1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10848-100UL
This item is not returnable.
View return policy
Description
ARPM1 Polyclonal specifically detects ARPM1 in Mouse samples. It is validated for Western Blot.
Specifications
ARPM1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
actin related protein M1, actin-related protein M1, MGC15664 | |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse ARPM1 (NP_083966.1). Peptide sequence DVAKLAPANTAVQVIAPPERKISVWMGGSILASLSAFQDMWITAAEFEEV | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
84517 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction