missing translation for 'onlineSavingsMsg'
Learn More

ARPM1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10848-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310724

  • 3427.56 DKK / 100µL
Estimated Shipment: 28-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ARPM1 Polyclonal specifically detects ARPM1 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

ARPM1
Polyclonal
Western Blot 1.0 ug/ml
actin related protein M1, actin-related protein M1, MGC15664
The immunogen is a synthetic peptide directed towards the C terminal region of mouse ARPM1 (NP_083966.1). Peptide sequence DVAKLAPANTAVQVIAPPERKISVWMGGSILASLSAFQDMWITAAEFEEV
100 μg
Primary
Mouse
Purified
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
84517
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers