Alle primære antistoffer
Primære antistoffer, immunoglobuliner, der binder til specifikke proteiner eller andre biomolekyler, bruges i mange forskningsapplikationer og protokoller til at påvise mål af interesse. De er udviklet ved hjælp af forskellige dyreværter, herunder mus, rotte, kanin, ged, får og mange andre.
Monoklonale
og polyklonale antistoffer En type primære antistoffer, monoklonale antistoffer, giver høj reproducerbarhed og lav krydsreaktivitet og baggrundsstøj. En anden type, polyklonale antistoffer, koster ofte mindre og giver større affinitet og hurtigere binding. Begge er produceret ved hjælp af plasma B-celler, men førstnævnte bruger den samme klon, og sidstnævnte bruger forskellige kloner. Monoklonale antistoffer kræver hybridomcellelinjer, og polyklonale antistoffer gør det ikke.
Der er også rekombinante monoklonale antistoffer med lignende fordele, såsom høj affinitet, skalerbarhed og specificitet. De er produceret vha in vitro kloning af plasma B-celler og ekspressionsværter.
Konjugerede primære
antistoffer Antistoffer kan mærkes med forskellige fluoroforer eller detektionsmidler eller anvendes uden mærker. Mærkede primære antistoffer, også kendt som konjugerede primære antistoffer, hjælper forskere med at forenkle og strømline deres applikationer. De er koblet med almindelige enzymer og farvestoffer såsom Alexa Fluor og bruges ofte i protein- og celleanalyse.
Anvendelser Antistoffer til biovidenskabsapplikationer bruges i flowcytometri, western blotting, ELISA, immunhistokemi og immuncytokemi. Sekundære antistoffer kan tilsættes for at understøtte påvisning og oprensning af visse antigener. De binder til det primære antistof, som binder til antigenet af interesse. At finde den rigtige kombination af antistoffer kan resultere i større antigenspecificitet og et stærkt, detekterbart signal.
- (983)
- (16)
- (141)
- (483)
- (3)
- (4)
- (329)
- (74)
- (1)
- (788)
- (3)
- (2)
- (7)
- (2)
- (124)
- (2)
- (5)
- (93)
- (135)
- (53)
- (744)
- (2)
- (5)
- (4,552)
- (5,866)
- (2)
- (2)
- (28)
- (27)
- (7)
- (6)
- (1)
- (137)
- (233)
- (1)
- (74)
- (2)
- (1)
- (8,675)
- (43)
- (419)
- (743)
- (6)
- (348)
- (2)
- (1)
- (147)
- (1)
- (9)
- (10)
- (62)
- (2)
- (23)
- (621)
- (30)
- (8)
- (82,357)
- (2)
- (57)
- (46)
- (182)
- (18)
- (383)
- (3,128)
- (3)
- (3)
- (1,329)
- (6)
- (3)
- (386,968)
- (24)
- (11,999)
- (10,790)
- (1,525)
- (374)
- (215)
- (77)
- (5,822)
- (4)
- (168)
- (17)
- (2)
- (28)
- (914)
- (7)
- (2)
- (15)
- (18)
- (1)
- (182)
- (10)
- (291,944)
- (2,540)
- (21,373)
- (83)
- (2)
- (50)
- (39)
- (1)
- (4)
- (139)
- (2)
- (23,507)
- (96)
- (1)
- (134)
- (824)
- (11,500)
- (3)
- (2)
- (163)
- (25)
- (2)
- (9)
- (761)
- (2)
- (2)
- (72)
- (29)
- (3)
- (309)
- (1,232)
- (2,371)
- (4)
- (225,267)
- (143,085)
- (153)
- (25)
- (166,869)
- (465,102)
- (2)
- (2)
- (3)
- (75)
- (1,275)
- (35,235)
- (14)
- (244)
- (12,275)
- (490,450)
- (203)
- (1)
- (480)
- (2)
- (3)
- (372)
- (6)
- (4)
- (155,678)
- (2,178)
- (3)
- (49)
- (507)
- (3)
- (657)
- (1,069)
- (1,274)
- (6)
- (8)
- (974)
- (4)
- (3)
- (50)
- (10,859)
- (6)
- (721)
- (34)
- (9)
- (2)
- (389)
- (4)
- (3)
- (2)
- (22)
- (42)
- (1,202)
- (2)
- (19)
- (1,799)
- (1)
- (4)
- (228)
- (451)
- (261)
- (34)
- (24,799)
- (22)
- (1)
- (92)
- (78)
- (555)
- (1,948)
- (5)
- (2)
- (3)
- (2)
- (21,372)
- (13)
- (2)
- (4)
- (1,295)
- (3)
- (2)
- (2)
- (1)
- (135)
- (2)
- (2,336)
- (93)
- (3)
- (12)
- (23)
- (1,099)
- (1)
- (4)
- (2)
- (3,638)
- (4,040)
- (3,224)
- (1)
- (11)
- (5,204)
- (2)
- (450)
- (428)
- (3)
- (22)
- (32)
- (9)
- (2,560)
- (168)
- (3)
- (13)
- (44)
- (1)
- (2)
- (3)
- (1)
- (2)
- (895,952)
- (3)
- (8,252)
- (46)
- (10)
- (90)
- (1)
- (8)
- (743,790)
- (6)
- (3)
- (620,561)
- (30,149)
- (62)
- (545)
- (1)
- (2)
- (1)
- (3,044)
- (874)
- (2,278)
- (4,142)
- (1)
- (1)
- (1)
- (1,299)
- (972)
- (810,668)
- (11,365)
- (9)
- (833)
- (54)
- (1)
- (5)
- (1)
- (4,916)
- (832)
- (1,520)
- (196)
- (1)
- (4)
- (4,089)
- (883)
- (3)
- (408)
- (4)
- (1)
- (3,278)
- (3,716)
- (2)
- (1)
- (1)
- (5)
- (1)
- (256)
- (134)
- (43)
- (1)
- (1)
- (1)
- (117)
- (230)
- (3)
- (1)
- (12)
- (266)
- (152,080)
- (209,776)
- (1)
- (805)
- (10,593)
- (1)
- (2)
- (9)
- (10)
- (2)
- (6)
- (20)
- (1)
- (7)
- (34)
- (15)
- (4)
- (1)
- (103)
- (1)
- (1)
- (20)
- (9)
- (20)
- (3)
- (12,768)
- (617)
- (1)
- (2)
- (3)
- (2)
- (179)
- (343)
- (219)
- (81)
- (1)
- (1)
- (6)
- (23,532)
- (2)
- (5,126)
- (2)
- (64)
- (1)
- (10)
- (1)
- (4,380)
- (3,081)
- (1)
- (74)
- (1)
- (1)
- (1)
- (2)
- (16,715)
- (17,036)
- (5,633)
- (285)
- (15)
- (14)
- (1)
- (101)
- (564)
- (19)
- (1)
- (1)
- (1)
- (2)
- (2,128)
- (1)
- (3)
- (1)
- (6)
- (2)
- (1)
- (13,007)
- (2)
- (20)
- (1)
- (108)
- (1)
- (1)
- (5)
- (1)
- (1)
- (12)
- (1)
- (4)
- (40)
- (4,897)
- (7)
- (2)
- (2)
- (5)
- (4)
- (20)
- (249)
- (2)
- (11,458)
- (31,403)
- (1)
- (52)
- (1,482)
- (282)
- (7)
- (1)
- (9)
- (2,257)
- (1)
- (4,355)
- (83)
- (38)
- (1)
- (10)
- (1)
- (4)
- (30)
- (1)
- (990)
- (1)
- (1)
- (13)
- (4)
- (7)
- (2)
- (6)
- (1)
- (565)
- (2,719)
- (1)
- (15)
- (1,667)
- (2)
- (2)
- (2)
- (5)
- (5)
- (56,670)
- (72)
- (96)
- (6)
- (1,411)
- (21,218)
- (35)
- (51)
- (3)
- (112)
- (8)
- (22)
- (565,250)
- (1)
- (7)
- (8)
- (652,486)
- (61,505)
- (5)
- (29,146)
- (186)
- (1)
- (1)
- (25,513)
- (9)
- (4)
- (1)
- (10)
- (2,869)
- (66)
- (105)
- (301)
- (1)
- (4)
- (2)
- (1)
- (17)
- (31,274)
- (31,336)
- (6)
- (32,199)
- (16)
- (30,967)
- (71)
- (48)
- (31,307)
- (2)
- (32,076)
- (1)
- (3)
- (1)
- (74)
- (31,743)
- (31,254)
- (17,368)
- (17,334)
- (17,225)
- (17,385)
- (17,191)
- (23)
- (106)
- (5)
- (16)
- (97)
- (97)
- (62)
- (16)
- (32,869)
- (11)
- (217)
- (713)
- (924)
- (611)
- (689)
- (811)
- (758)
- (868)
- (716)
- (1,268)
- (798)
- (725)
- (897)
- (936)
- (919)
- (1)
- (603)
- (933)
- (31)
- (8)
- (27,423)
- (839)
- (5)
- (124)
- (4)
- (657)
- (6)
- (149)
- (81)
- (49)
- (309)
- (13)
- (5)
- (3)
- (13)
- (4)
- (18)
- (1)
- (26,923)
- (26,946)
- (27,065)
- (43)
- (26,982)
- (26,908)
- (40)
- (26,940)
- (26,938)
- (26,924)
- (8)
- (10)
- (17)
- (18)
- (30,189)
- (3)
- (5)
- (42)
- (1)
- (4)
- (3)
- (4)
- (237)
- (1,273)
- (27,254)
- (14,111)
- (25,958)
- (4,866)
- (4,867)
- (25,938)
- (14,068)
- (7)
- (7)
- (13)
- (1)
- (182)
- (32)
- (55)
- (103)
- (56)
- (220)
- (278)
- (53)
- (152)
- (62)
- (24)
- (56)
- (80)
- (30)
- (123)
- (126)
- (167)
- (142)
- (134)
- (26)
- (68)
- (68)
- (42)
- (58)
- (103)
- (95)
- (177)
- (220)
- (73)
- (102)
- (118)
- (126)
- (78)
- (449)
- (26,677)
- (7)
- (5)
- (258)
- (379)
- (2,762)
- (3,756)
- (24)
- (30)
- (265)
- (2,697)
- (2)
- (1)
- (127)
- (43)
- (22,742)
- (586)
- (612)
- (4)
- (14)
- (13)
- (5)
- (7)
- (62)
- (59)
- (872)
- (64)
- (1)
- (3)
- (1)
- (13)
- (5)
- (5)
- (39)
- (1)
- (370)
- (327)
- (169)
- (176)
- (115)
- (38)
- (16)
- (4)
- (5)
- (9)
- (3)
- (10)
- (2)
- (67)
- (5)
- (4)
- (441,965)
- (278)
- (49)
- (443)
- (83)
- (58)
- (29)
- (320)
- (1)
- (23,824)
- (23,810)
- (23,792)
Filtrerede søgeresultater
Invitrogen™ GAPDH Loading Control Monoclonal Antibody (GA1R), HRP
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ Pab1p Monoclonal Antibody (1G1)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Klon | 1G1 |
|---|---|
| Værtsarter | Mouse |
| Form | Liquid |
| Konjugeret | Unconjugated |
| Isotype | IgG2a |
| Koncentration | Conc. Not Determined |
| Primær eller sekundær | Primary |
| Genadgangsnr. | P04147 |
| Klassifikation | Monoclonal |
| Antigen | Pab1p |
| Gene Alias | Poly(A) binding protein |
| Gensymboler | PAB1 |
| Gene | PAB1 |
| Applikationer | Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry |
| Produkttype | Antibody |
| Immunogen | Yeast polyA binding protein preparations. |
| Indhold og opbevaring | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Formulering | Cell culture media with 5mM sodium azide |
| Målarter | Yeast,Bacteria |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 856912 |
Invitrogen™ PGK1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ HSP104 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ alpha Tubulin Monoclonal Antibody (YL1/2)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rat Monoclonal Antibody
Histone H2B, ubiquitylated Lys123 Antibody (1B3F12/A9), HRP, Novus Biologicals™
Mouse Monoclonal Antibody
Invitrogen™ GAPDH Loading Control Monoclonal Antibody (GA1R), DyLight™ 680
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Værtsarter | Rabbit |
|---|---|
| Form | Purified |
| Konjugeret | Unconjugated |
| Isotype | IgG |
| Fortynding | Western Blot 1:500 - 1:1000, ELISA |
| Primær eller sekundær | Primary |
| Klassifikation | Polyclonal |
| Antigen | NXF1 |
| Gene Alias | DKFZp667O0311, Mex67, mRNA export factor TAP, nuclear RNA export factor 1, TAPMEX67, tip associating protein, Tip-associated protein, Tip-associating protein |
| Applikationer | ELISA,Western Blot |
| Indhold og opbevaring | Store at -20°C. Avoid freeze-thaw cycles. |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NXF1 (NP_006353.2).,, Sequence:, ILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG |
| Formulering | PBS (pH 7.3), 50% glycerol |
| Målarter | Human,Mouse,Rat |
| Regulatorisk status | RUO |
| Gen-id (Entrez) | 10482 |
| Oprensningsmetode | Affinity purified |