missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
ZNF778 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3690.00 DKK
Tekniske data
| Antigen | ZNF778 |
|---|---|
| Applikationer | Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Form | Purified |
Beskrivelse
ZNF778 Polyclonal specifically detects ZNF778 in Human samples. It is validated for Western Blot.Tekniske data
| ZNF778 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_872337 | |
| 197320 | |
| Synthetic peptide directed towards the middle region of human FLJ31875. Peptide sequence AFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHTREKPFA. | |
| Primary | |
| 49 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ31875, MGC150573, zinc finger protein 778 | |
| ZNF778 | |
| IgG | |
| Protein A purified |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel