missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
ZNF670 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3690.00 DKK
Tekniske data
| Antigen | ZNF670 |
|---|---|
| Applikationer | Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Form | Purified |
Beskrivelse
ZNF670 Polyclonal specifically detects ZNF670 in Human samples. It is validated for Western Blot.Tekniske data
| ZNF670 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_149990 | |
| 93474 | |
| Synthetic peptide directed towards the N terminal of human ZNF670. Peptide sequence EDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVS. | |
| Primary | |
| 45 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ12606, MGC12466, zinc finger protein 670 | |
| ZNF670 | |
| IgG | |
| Protein A purified |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel