missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Novus Biologicals™ ZFX Recombinant Protein Antigen
Shop alle Bio Techne produkter
Klik for at se tilgængelige muligheder
Mængde:
0,1 ml
Beskrivelse
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZFX. Source: E.coli Amino Acid Sequence: IGPDGHPLTVYPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYHCTDCDYTTNKKISLHNHLESHKLTSKAEKAIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHL The ZFX Recombinant Protein Antigen is derived from E. coli. The ZFX Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-80583. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Tekniske data
Tekniske data
| Gen-id (Entrez) | 7544 |
| Arter | Human |
| Oprensningsmetode | Chromatography |
| Renhed | >80% |
| Koncentration | 0.5mg/mL |
| Indhold og opbevaring | Store at -20°C. Avoid freeze-thaw cycles. |
| Formulering | PBS and 1M Urea, pH 7.4. |
| Til brug med (applikation) | Blocking/Neutralizing, Control |
| Gen symbol | ZFY |
| Etikettype | Unlabeled |
| Vis mere |
For Research Use Only
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion