missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ ZFX Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP1-80583PEP

Additional Details : Weight : 0.00970kg

Product Code. 18310950

  • 1842.28 DKK / 0.10mL
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!



A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZFX. Source: E.coli Amino Acid Sequence: IGPDGHPLTVYPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYHCTDCDYTTNKKISLHNHLESHKLTSKAEKAIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHL The ZFX Recombinant Protein Antigen is derived from E. coli. The ZFX Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-80583. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.



PBS and 1M Urea, pH 7.4.
Store at -20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80583. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Product Suggestions

Product Suggestions



Special Offers

Special Offers

For Research Use Only