missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. YY2 Antibody - Azide and BSA Free, R&D Systems™

YY2 Antibody - Azide and BSA Free, R&D Systems™

Artikelnummer. 18603160 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.02 mL
0.1 mL
Pakningsstørrelse:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde Pakningsstørrelse
18603160 0.02 mL -
18660751 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18603160 Leverandør Novus Biologicals Leverandørnr. NBP2939050.02ml
 Begrænset vare
Forventet forsendelse: 02-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

YY2 Polyclonal specifically detects YY2 in Human, Mouse, Rat samples. It is validated for ELISA, Immunocytochemistry/Immunofluorescence, Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen YY2
Applikationer ELISA, Immunocytochemistry/Immunofluorescence, Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias transcription factor YY2, YY2 transcription factor, ZNF631
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY2 (NP_996806.2). GEGQAENPPDYSEYLKGKKLPPGGLPGIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRR
Oprensningsmetode Affinity purified
Mængde 0.02 mL
Regulatorisk status RUO
Forskningsdisciplin Endocrinology
Primær eller sekundær Primary
Gen-id (Entrez) 404281
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at -20°C. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.