missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR20RT Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10156-100UL
Additional Details : Weight : 0.00970kg
Description
WDR20RT Polyclonal specifically detects WDR20RT in Mouse samples. It is validated for Western Blot.Specifications
| WDR20RT | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 70948 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| The immunogen is a synthetic peptide directed towards the N terminal region of mouse WDR20 (NP_081890.1). Peptide sequence KETNEIKTHFTTREGLYRLLPHSEYSRPNRVPFNSQGSNPVRVSFVNLND | |
| 100 μg | |
| Primary | |
| Mouse | |
| Purified |