missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30499004

TLK1 Antibody [Biotin], Novus Biologicals Biologicals™

Artikelnummer. 30499004 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30499004 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30499004 Leverandør Novus Biologicals Leverandørnr. NBP335473B

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

TLK1 Polyclonal antibody specifically detects TLK1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen TLK1
Applikationer ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret Biotin
Formulering PBS
Gene Alias EC 2.7.11, EC 2.7.11.1, KIAA0137serine/threonine-protein kinase tousled-like 1, PKU-beta, SNARE protein kinase SNAK, tousled-like kinase 1serine threonine protein kinase
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human TLK1 (NP_036422.3).,, Sequence:, PVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQ
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Apoptosis, Cancer, Cell Cycle and Replication, Checkpoint signaling, Chromatin Research, DNA Repair, Tumor Suppressors
Primær eller sekundær Primary
Gen-id (Entrez) 9874
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.