missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MED28 Antibody, R&D Systems™

MED28 Antibody, R&D Systems™

Product Code. 18614466 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Förpackningsstorlek:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkode Quantity Förpackningsstorlek
18614466 25 μL 25µL
18127348 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
Denne vare kan ikke returneres. Se returpolitik
Produktkode 18614466 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP23827125ul
 Restricted Item
Forventet forsendelse: 01-12-2026
Tilføj til indkøbskurv
Tilføj til indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolitik

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MED28 Polyclonal specifically detects MED28 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen MED28
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9H204
Gene Alias DKFZP434N185, EG1DKFZp434N185, magicin, mediator complex subunit 281500003D12Rik, mediator of RNA polymerase II transcription, subunit 28 homolog (S. cerevisiae), subunit 28 homolog
Gene Symbols MED28
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQV
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 80306
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.