missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. TIPRL Antibody, R&D Systems™

TIPRL Antibody, R&D Systems™

Artikelnummer. 18605417 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18605417 25 μL
18217584 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18605417 Leverandør Novus Biologicals Leverandørnr. NBP25502425ul
  • ONLINE EXCLUSIVE PRICE
    3420.54 DKK
    2938.95 DKK / 25µL
    Spare 481.59 DKK
    14% Slukket
 Begrænset vare
Forventet forsendelse: 01-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

TIPRL Polyclonal specifically detects TIPRL in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen TIPRL
Applikationer Immunocytochemistry, Immunofluorescence, Immunofluorescence
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Formulering PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias dJ69E11.3, MGC3794, putative MAPK activating protein, Putative MAPK-activating protein PM10, TIP41, TOR signaling pathway regulator-like (S. cerevisiae), TIP41-like protein, TIP41Type 2A-interacting protein, TIPTIP41, TOR signalling pathway regulator-like (S. cerevisiae)
Gensymboler TIPRL
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RIDGVLIRMNDTRLYHEADKTYMLREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLI
Oprensningsmetode Affinity Purified
Mængde 25 μL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 261726
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Produkttype Antibody
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.