missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
STAU2 Antibody [Janelia Fluor« 525], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38039JF525
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
STAU2 Polyclonal antibody specifically detects STAU2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Tekniske data
| STAU2 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 27067 | |
| Store at 4°C in the dark. | |
| Purified |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Janelia Fluor 525 | |
| DKFZp781K0371,39K2, double-stranded RNA-binding protein Staufen homolog 2,39K3, MGC119606, staufen (Drosophila, RNA-binding protein) homolog 2, staufen homolog 2, staufen, RNA binding protein, homolog 2 (Drosophila) | |
| A synthetic peptide corresponding to a sequence within amino acids 300-400 of human STAU2 (NP_001157852.1).,, Sequence:, PEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPG | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion