missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. SRGAP3 Antibody, R&D Systems™

SRGAP3 Antibody, R&D Systems™

Artikelnummer. 18602596 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
25 μL
0.1 mL
Pakningsstørrelse:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde Pakningsstørrelse
18602596 25 μL -
18194689 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18602596 Leverandør Novus Biologicals Leverandørnr. NBP23852125ul
 Begrænset vare
Forventet forsendelse: 02-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SRGAP3 Polyclonal specifically detects SRGAP3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen SRGAP3
Applikationer Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Genadgangsnr. O43295
Gene Alias SLIT-ROBO Rho GTPase activating protein 2, SLIT-ROBO Rho GTPase activating protein 3
Gensymboler SRGAP3
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RIESPEKRRMATFGSAGSINYPDKKALSEGHSMRSTCGSTRHSSLGDHKSLEAEALAEDIEKTMSTA
Oprensningsmetode Affinity Purified
Mængde 25 μL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 9901
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Produkttype Antibody
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.